DPCstruct | MC40288
Metacluster Properties and Pfam Annotations
| Number of structural domains | 123 |
|---|---|
| Mean domain length (aa) | 136 ± 36 aa |
| Standard deviation of domain lengths | 36.30 |
| Length coefficient of variation | 0.27 |
| Mean AlphaFold2 pLDDT confidence score | 79.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.95 |
| Pfam Score | 96.19 |
| Assigned Pfam label(s) | PF17777- PF16320- PF00687- PF00466 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1F194 | 11-153 | LPSIRAAVELARQEVLRRELAECHLVAGIWCHGFKVAQMLSIRANLPQTARLVVAKNSNVAEAVAGTRWEAVRPFAQGMNTWLFVRS… |
| A0A0N0BEX7 | 72-247 | KPLGPYDQIIAREVRNWFDNSKMVVCLHVNSIKELDVFDIKVALFKENMHYKYYGTHIVNNVIKNSPYEALAPLVSKCTSFVFSPVI… |
| A0A202DSU5 | 29-116 | None |
| A0A498LPU9 | 68-206 | None |
| A0A1Y1VWM8 | 42-198 | None |
| A0A1D2N0W0 | 661-760 | None |
| H1A2X1 | 111-236 | None |
| A0A177WMK7 | 23-128 | None |
| A0A438E3Y5 | 236-383 | None |
| A0A537TP43 | 96-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.