DPCstruct | MC40287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 207 ± 58 aa |
| Standard deviation of domain lengths | 57.87 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | PF00696- CL0020- PF00889 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1EMZ8 | 2-206 | NLIKKLQERMSALIKDVKVFLVSCNWDIDAPQKDLRKRGVVLAAKKSSRTATEGLLAIARDEETAVVVELNCEIDFVTRNDVFQYLA… |
| A0A6J6HSH6 | 2-202 | LELNCETDFVAKGERFIALGDELVEHLLSSKSADVASFLSSTMANGKTVQSVIDEGNATLGEKIEIRNVAVIEGPVGLYLHKTSPDL… |
| A0A2H6K6D8 | 20-272 | None |
| A0A2H6KF46 | 97-307 | None |
| A0A837Q5Z1 | 2-146 | None |
| A0A645J3K2 | 2-133 | None |
| A0A396HHR5 | 28-170 | None |
| A0A388Q3R3 | 3-100 | None |
| T0CFX2 | 22-201 | None |
| G7IIM4 | 18-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.