DPCstruct | MC40285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 120 ± 18 aa |
| Standard deviation of domain lengths | 17.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1E9T6 | 100-222 | LSSFSIDCKGDVCKGDTILFKQKVFKKRKGKQDTQCIGRRTIAGKVVKEKYTKKRQLHNFTIMVLWSEGVNNLPALHQLIISGHQLY… |
| A0A2R6W7E1 | 183-290 | INCTGDVCKGDVVKFKRKVYKAGKPRKGAEAIGEHLVVGRVVKESYGEKKQQHTFTVEVLWSAGYKPLPPMRQLLVKGRNLYKLRTY… |
| A0A4S4CYZ0 | 357-488 | None |
| A0A5P1FGF4 | 18-141 | None |
| A0A2D8HDD9 | 7-119 | None |
| A0A1R3K503 | 526-675 | None |
| A0A2U1QFA7 | 56-156 | None |
| A0A7I4CLU7 | 139-284 | None |
| A0A7I4CM22 | 38-190 | None |
| A0A287HJX4 | 20-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.