DPCstruct | MC40283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 146 ± 24 aa |
| Standard deviation of domain lengths | 24.22 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02620 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419F8Q9 | 12-161 | PQKYRHRGPASQYVGEAAEFPGEITVWAVAEKENPGLIRVDLTVEVPGEFACDRCGREFQQTHRAQEDFYFAYEGKASARAGGDEDF… |
| A0A849K7G2 | 3-154 | EVATVVAAPADLGTAVIGVPEGADLTLGLRLEAVMEGVLVSGVVRGTAVGECARCLDPISQEVTVRVQELFVYPERAEAAEEAGDEE… |
| A0A287XXP6 | 1-146 | None |
| A0A6H5LE35 | 122-294 | None |
| A0A0E0GX36 | 150-296 | None |
| A0A1Z8X603 | 15-144 | None |
| A0A645JAB0 | 1-90 | None |
| A0A2X3VIZ7 | 190-352 | None |
| A0A6C1NPG7 | 72-231 | None |
| A0A6J0PS34 | 14-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.