DPCstruct | MC40282
Metacluster Properties and Pfam Annotations
| Number of structural domains | 78 |
|---|---|
| Mean domain length (aa) | 224 ± 40 aa |
| Standard deviation of domain lengths | 39.78 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 26.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1D0G8 | 150-350 | VSRCVDCHVALRNSFRRHIRSDSVGCALCHDGVTPLRPAGSQSEYLCFKCHEERRGMFSREFIHGPVAGGSCTTCHDPHASRYDHIL… |
| A0A3A4PNL7 | 6-175 | VGHEPVTTGKNCANCHNPHGSDVPRILADTEIHLCLGCHDEPMDTPNGPIVDMKSWIDTNPEHHGPIRDGNCTGCHQPHGSENFRIL… |
| A0A285NNY5 | 133-351 | None |
| A0A1F5C6V1 | 34-202 | None |
| A0A7Y8J141 | 7-243 | None |
| A0A2H0AFT5 | 3-183 | None |
| A0A3M1ED61 | 86-324 | None |
| A0A3M1EA38 | 34-260 | None |
| A0A2U3K3X3 | 14-222 | None |
| A0A3M1GCN3 | 45-285 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.