DPCstruct | MC40281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 114 ± 13 aa |
| Standard deviation of domain lengths | 13.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 19.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M1CHU0 | 5-110 | VATALWHYGLGLLRAVRVERLEADIEGGFEEPHLTGQVYGFYQAAYGVAPAVVSRVRYRPDWSGASFDGSAGVAVAIPLYRLFYQTV… |
| A0A1V2M010 | 268-369 | EYKNTAWRGMYRTLRNIIRVVNPDHVDFDISIGLDKHEDTGRMLAKIYVFIPYYAKYGNINGNFTEKGIWGNVEIEGKFNLYKIIRP… |
| A0A7V5GXB4 | 134-259 | None |
| A0A828T4F8 | 7-111 | None |
| A0A1G4VVX5 | 54-206 | None |
| A0A7U6KDP4 | 149-251 | None |
| A0A3R6P2G7 | 119-244 | None |
| A0A7V6UDH2 | 3-121 | None |
| A0A843GAE6 | 12-121 | None |
| A0A316M3B0 | 136-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.