DPCstruct | MC40280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 68 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 60.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y0CFH4 | 28-96 | ALLAEGVFVGSGIFKSGNPAARAAAIVKATTFHDDSDVLAKVSRGLGEAMVGINVDDIPQPHRLAERGW |
| A0A7X8QJM8 | 1-56 | GAEGVFVGSGIFRSGDPVKRAKAIVKAVANYENYDLLTEVSTNLGEAMVGLNPEEA |
| A0A2H9TPY4 | 145-227 | None |
| A0A835HKF7 | 496-576 | None |
| A0A7J2RZE4 | 10-78 | None |
| A0A7V9H7E9 | 52-127 | None |
| A0A1V5JRK7 | 178-255 | None |
| A0A5A7R3Q5 | 877-957 | None |
| A0A1Q6SV85 | 1-51 | None |
| A0A7C6QX73 | 105-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.