DPCstruct | MC4027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 149 ± 21 aa |
| Standard deviation of domain lengths | 20.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 31.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517LNG0 | 333-465 | KAKQWNIAETFQKELDIATHFMHHPDFVEGVTARLINRTKERPKWNPNSLEEVTDAQVKAFFTPVSGERLALLETGDHATFADYPHA… |
| A0A0C4CSH3 | 3-116 | HPDFTEGVTAKLINKPPTKPKWSPATLDQVQDSDVKAFLRQPEPEATPAPIQFHNDADFHEYPHRQFGLPSEKDVHNLLTDGVPRSQ… |
| A0A093XNE7 | 335-499 | None |
| A0A4U0W8R8 | 256-415 | None |
| A0A367KJP7 | 325-465 | None |
| I1BI06 | 1-170 | None |
| A0A1R1PIY5 | 155-286 | None |
| A0A5B0RD05 | 1-159 | None |
| A0A4S4KN57 | 72-256 | None |
| A0A367JF55 | 13-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.