DPCstruct | MC40263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 123 ± 14 aa |
| Standard deviation of domain lengths | 13.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14058 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B2BGT5 | 1-118 | MKGTEHFTRTIAEYLNQRAMTDPLFAPNLMKPNKNIEECITYILNEVQKSGCNGFDDDEIFSMAVHYYDEDDIEVGKAISCQVAVNH… |
| A0A843Y4V6 | 1-107 | MKGSETFKKVIKAYLDKRAAEDELFAKDYAKPGKNIDDCCDFIISEVKKSGRQGFDDDEIYGIAIHYYNEEEVSFTKNQNCTIVTNL… |
| A0A4S2AVG6 | 41-168 | None |
| F3ZU27 | 1-92 | None |
| A0A3N2KS75 | 20-161 | None |
| A0A6N2RD09 | 203-320 | None |
| A0A1G7WKS8 | 56-186 | None |
| A0A645BCM9 | 2-122 | None |
| A0A1H4CGF2 | 1-136 | None |
| A0A1B1S7R4 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.