DPCstruct | MC40262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 173 |
|---|---|
| Mean domain length (aa) | 225 ± 41 aa |
| Standard deviation of domain lengths | 41.30 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 18.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08867 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1A6AJ02 | 143-395 | IDYISTLDMYVKRINSLQDDNCNRIVWYRGQSNIKYELIPSIYRKDKQTKKYLLDYKTEKDYLSFFKAQSFPFLKNIPQSDWEWLIL… |
| A0A1F9BMK2 | 202-427 | INDWNDYKNYVNDLEDRRFIFRGHKDNRRRLRTTFHRGGRADLNKFEREDIETLHKHLCARTRHFFDLKDPKENGAFHNLIRHHGYP… |
| A6VW43 | 95-343 | None |
| A0A1G7TKU7 | 3-145 | None |
| A0A378C836 | 12-151 | None |
| A0A108T735 | 1-168 | None |
| A0A5R8QCZ8 | 81-328 | None |
| A0A8B2CFT8 | 294-505 | None |
| A0A3E4QQ91 | 183-412 | None |
| A0A7C7ES13 | 3-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.