DPCstruct | MC40261
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 255 ± 18 aa |
| Standard deviation of domain lengths | 18.14 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A395T0G4 | 1-282 | MIHSTKSRVVGVVPLEVISKEPVPNLEVPDLSRMIHKMHLHEVNGPELRLRAFRMIPFFFGSIPAGRVPKDVDMFPAISILRPITEL… |
| A0A0D2Y6U3 | 1-236 | MENLGLKLQAIRLFPFFFSPLPQGARLNNADGQVIINSIRDFTAAQDHMFRETGIETADGKFEGFWRRGPASRVLGEYVTAHIESIS… |
| A0A094EHX6 | 45-307 | None |
| A0A7S8I2Z8 | 313-594 | None |
| A0A4E9EDD2 | 474-721 | None |
| A0A420TS70 | 115-360 | None |
| A0A2T4GWQ5 | 119-388 | None |
| A0A5C6SGS4 | 363-597 | None |
| A0A366S9U5 | 289-525 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.