DPCstruct | MC4025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 103 ± 6 aa |
| Standard deviation of domain lengths | 6.47 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 53.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V7B3R2 | 40-142 | MAFELYGMLAGNVSPMTGENVKPAYGGEEEAFLRKVVTPIYNVIAKEAARSKKGRSKHSQWRNYDDLNEYFWSADCFRLGWPMRADA… |
| A0A1D6KCZ4 | 208-303 | MALDLNHVIDQSIDIETGRPSVPAVHGVDAFLDKVVKPTYDVLEAEVKFSRNGTKPHSAWRNYDDVNEYFWSRRVFRRLQWPLSPAR… |
| A0A392P2N1 | 1-104 | None |
| A0A453Q8I0 | 12-118 | None |
| A0A453Q8Q3 | 256-362 | None |
| A0A151TL88 | 168-269 | None |
| A0A5D3BGT4 | 347-444 | None |
| A0A7C9EUH7 | 17-112 | None |
| A0A287PW09 | 106-207 | None |
| A0A835HAG8 | 209-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.