DPCstruct | MC40249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 3.59 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00082 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5T5K2 | 9-60 | MEWGIVRGNDVELYGEKGKAYLMRGAKPLPGITDYPDVAAGYGRLCVEQSIP |
| A0A6S6QZ78 | 277-333 | TGSVALMMEWGIVNGNDPYMYGEKMKAYLIAGARKLSFEQVYPNPTFGFGALCLRET |
| A0A645HK63 | 2-50 | None |
| A0A6B1TX44 | 29-85 | None |
| A0A3R6TXV9 | 63-122 | None |
| B7ASC9 | 182-241 | None |
| A0A1I5W616 | 455-512 | None |
| R6EP83 | 1-52 | None |
| A0A1C6HPF3 | 232-290 | None |
| T0NE83 | 160-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.