DPCstruct | MC40248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Standard deviation of domain lengths | 12.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 37.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A559UWD3 | 11-117 | EWKFSRHETFPPRFGWLHKAYMQVKEREDIFHLDDALVRLGVGKNMVYAMRYWSQAFKLTHEYPHSDPRNRALVAAPTWRARWLLDE… |
| A0A7T8P3H1 | 2-86 | TDLSTLELHFSGHETFPLRNMWLKRVCDQADQDGRIAKSVFTDEEAIVRFGVGKNMVSSMKHWALATGMILDENSSKILSSVIFS |
| R5YXP7 | 1-86 | None |
| A0A1J5QL28 | 2-92 | None |
| A0A367EKJ3 | 53-171 | None |
| A0A0P9RVT0 | 97-199 | None |
| A0A6B1DD44 | 26-130 | None |
| A0A7G7VSJ8 | 1-90 | None |
| A0A1L9ATV7 | 8-92 | None |
| A0A3M7LJ70 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.