DPCstruct | MC40247
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 107 ± 9 aa |
| Standard deviation of domain lengths | 8.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 90.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03925 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H4P7S9 | 5-109 | LLSDEYADQKRAVNRFMLVLTTLYSLDSKAFAEATESLHGRTRVYFAEDERTLQKNGNQTKPKQVPGTPWWVITNTNTGRKCSMIEH… |
| A0A7G3EVN7 | 1-86 | STLYSLDNNAFAEATESLHGRTRVYFAGDEQTLLQNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGTI |
| A1STA5 | 91-207 | None |
| A0A379WDL6 | 2-89 | None |
| A0A7C4QYE9 | 110-217 | None |
| A0A3L0VY88 | 117-229 | None |
| B5JFJ7 | 40-148 | None |
| A0A558I716 | 90-197 | None |
| A0A336N828 | 18-125 | None |
| Q12MQ7 | 140-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.