DPCstruct | MC4024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 143 ± 6 aa |
| Standard deviation of domain lengths | 5.94 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 87.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 43.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6I9P6F5 | 54-202 | MFLPHIGLSELEDECFSKILPKAVTMFDRMMKEIMDHVGGLSSQNTELCSLLRNILQAMMQIINALSTCVRHVGSFGETPDIDAIRS… |
| A0A3P8UED4 | 1-140 | MFLPHIGLSELEDECFSKILPKAVTVFHSMMKEIIDQVGRLSSQNTELCGFLRNILQGMMQIIDALSTCVRHVGSFEEAPDLEAIRS… |
| A0A3Q0E9U6 | 59-207 | None |
| F6VSI8 | 47-191 | None |
| A0A2I0UHU0 | 26-176 | None |
| A0A060ZBL2 | 2-141 | None |
| A0A2C9M543 | 2-133 | None |
| K7GGN1 | 22-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.