DPCstruct | MC40238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 54 ± 2 aa |
| Standard deviation of domain lengths | 2.13 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 51.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8R2J3 | 268-320 | TPSPLSTNGTCGPAWGHATCTGTNFGKCCSTSGYCGSTPDYCGAGNCVSGACS |
| S8AI80 | 122-174 | SAPAISTDGNCGPNKNGKTCIGSTYGDCCNAAGKCGSGDSYCGIGNCLEGSCV |
| A0A6A6TVS6 | 134-190 | None |
| C1H9L9 | 447-501 | None |
| A0A6A5X6L2 | 559-611 | None |
| G2Q9Y7 | 2-59 | None |
| E4URQ3 | 413-464 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.