DPCstruct | MC40236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 127 ± 16 aa |
| Standard deviation of domain lengths | 16.05 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 40.98 |
| Pfam Score | 84.72 |
| Assigned Pfam label(s) | CL0023- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4DYY4 | 215-331 | VAITDLPRNSLHLVICLMEAQELAAVSGVCSLFRHLAYEVVPGLNLVLYEHQRKGLKWMLYRETPSLTSCVTSHPYLFPRRPGRKSS… |
| A0A1S4DDC4 | 225-364 | KRGNPDSLRVNPLDSSRSGIWVVTDDILINILSSLCPVDLLRVSATCRHLRFLAASIMPCMKLKLFAHQQAAVDWMLQREHNVELLQ… |
| W3A1N5 | 1-151 | None |
| A0A1D6N127 | 209-350 | None |
| A0A287MLL1 | 8-128 | None |
| A0A5J4XK04 | 2-104 | None |
| A0A438CWJ1 | 59-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.