DPCstruct | MC40234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 17.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 22.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2N353 | 26-130 | GAEAPLILITTVDIGEGRADRIEVREGDDPLDLARAFVQKHGLPAAITDALAQHLRDNLRDVAAQHAAQQLASQQGQQAAGRGKEPA… |
| A0A1C7NHX6 | 374-504 | GNRRVFIPTETAPPPPPKNSLLVTVNVELSESVKVPVPIRELDEPSKLAQEFGEKYKVQTPSVIAALTKLFSSQKELAAKKKQQKLQ… |
| R1D771 | 19-147 | None |
| A0A7S1G8B4 | 60-174 | None |
| A0A5B8MGH9 | 165-279 | None |
| A0A7S1LP33 | 4-111 | None |
| A0A7S1AEQ2 | 14-130 | None |
| A0A176WE77 | 95-219 | None |
| A0A1Q9F592 | 1-112 | None |
| A0A6A5BKK6 | 530-682 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.