DPCstruct | MC40231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 187 ± 16 aa |
| Standard deviation of domain lengths | 15.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 86.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2MZC6 | 218-408 | APPAAPAALLDLLQRRLSQRDVINASVFDLLTSQCDRHAENVYVSAAGQLSLIDNDQAYGSSWRPCGVDSIFLPGTQKFEISRLGFN… |
| A0A250WR37 | 192-378 | AEGISLENLVRLGKPMMHPNDLLKIMHETVNKTQVVHAAIFDLLTSQCDRHAQNLFIAENGGIKLIDNERSFYENHWCALDSILLPT… |
| A0A830HN08 | 299-501 | None |
| A0A7S0KCZ7 | 96-272 | None |
| A0A835Y4T7 | 487-681 | None |
| C1E6H2 | 248-438 | None |
| C1E243 | 333-490 | None |
| A8IW85 | 2-154 | None |
| A0A7S0RGC3 | 16-209 | None |
| K8F6C9 | 300-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.