DPCstruct | MC4023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 113 ± 16 aa |
| Standard deviation of domain lengths | 15.73 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 83.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05284 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A419R4H5 | 1-82 | MNALSIQRAIRLVPNDNRVSDNAPAFRVMLGWQHIGDAWERMSRTEPPREYWRVRIDDPFCPLSAMLFPDAEGMTAQLVLQV |
| A0A2T9JL57 | 4-109 | LVIGNFKPSRGGGWEGEFRTLVANAKVRFVPNDDRAGPNAPAFRVMLGSSRIGDAWEARWGGDRARSFFRVSLDDPFLPAPVSAALF… |
| A0A222X4H0 | 114-231 | None |
| A1AYA9 | 201-305 | None |
| A0A109C0L2 | 122-222 | None |
| A0A2S7K9P6 | 1-109 | None |
| A0A7Y9N4W2 | 9-122 | None |
| A0A7C2J193 | 1-85 | None |
| A0A2N5CQ93 | 2-106 | None |
| A0A0F6IIU9 | 39-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.