DPCstruct | MC40229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 175 ± 16 aa |
| Standard deviation of domain lengths | 16.49 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 65.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2MT37 | 1-195 | MHRICTRRDAEASRLPRPCFFVDKAWHAQQAGADAVLVVNDRGGELSTAVSPRDDEGAARLLGDLTLSAGLISQEDGAALKDLLRHG… |
| A0A287P052 | 100-277 | GECFFTTKAWNAQLAGAAAILVVDSKDEPLITMDNPEDTGTKHLENITIPSVLITKKLGEDLKKSAENGDMVSVLLDWRESLPHPDE… |
| A0A1R3G773 | 101-260 | None |
| A0A7G2EYX9 | 85-278 | None |
| A0A811N1Z5 | 106-282 | None |
| A0A287R245 | 43-201 | None |
| A0A287R2B9 | 41-219 | None |
| A0A2G3BM34 | 97-279 | None |
| A0A7S2UWY7 | 13-209 | None |
| A0A0E0R3F3 | 105-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.