DPCstruct | MC40226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 296 ± 64 aa |
| Standard deviation of domain lengths | 63.80 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2MJ36 | 31-326 | EVSRLKEAVASGRSRTWHHAFSVAFFGALMFVAGAAPGALPALFLGFVFVGLPWRFVSFISKRWLFFCIDFCYFVNVAAAAFLLAAP… |
| A0A7S2RM06 | 88-434 | ASGAQPSILLALRQLERDADKLRNAGLSAFTFTLGIANLLLSAFLFGAMGHSFWLVYGVQGLLIIGYRVAKSLERSRTSGVNVMWYF… |
| A0A7S3PJA9 | 4-287 | None |
| A0A814X084 | 906-1235 | None |
| A0A1E4SQG8 | 83-445 | None |
| A0A2T6ZGA3 | 4-255 | None |
| A0A835RT42 | 60-268 | None |
| A0A7R9VQD1 | 28-305 | None |
| A0A383WCW6 | 36-354 | None |
| A0A7S2MXU6 | 12-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.