DPCstruct | MC40224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 164 ± 21 aa |
| Standard deviation of domain lengths | 20.81 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.74 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 44.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2MGG8 | 4-159 | YMRRLEERDKAAARDADSDEERRRRAEPLLKETAFDRRKVVAVFKHDGSRGHHMSDYIPPEELAKFMEASGDKAAAARAKALQPNTL… |
| A0A397GFE2 | 199-344 | KKRAEEMKHTAGQAAMLTSQAEAKRAHHIADFLPKEELEKFEQKVKAVKTGGTTPEYEDYANNKLDQSNIGFKMLMKQGWQAGSGLG… |
| A0A2J6K2S4 | 240-403 | None |
| A0A7M7L3Q6 | 859-1024 | None |
| A0A7J6ZPJ2 | 785-939 | None |
| A0A1Y1KNX1 | 233-395 | None |
| A0A1S3YFR2 | 173-344 | None |
| A0A7S0VJK8 | 51-173 | None |
| A0A369SAE5 | 286-456 | None |
| A0A397VCP9 | 121-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.