DPCstruct | MC4022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 116 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T9JBF2 | 23-133 | RGLRFENDDHARWYKRFWTGNCQDLNLCFPGSPNWNDIVSKLLVKGGPAEKPALLPKACRLGQLIGMEWARDRRIKRISTQDLKRFS… |
| A0A1W1HH74 | 2-103 | FSRKEEEWYKKFQEGTFGVKGWKGRSKEILKPFSSDEKMNLKDKLDNLGEKIGREWAKDNSVRKIDTPMLQGWGKELLAAKDKGAET… |
| A0A7Z9YWA4 | 41-163 | None |
| A0A0P9F9T9 | 7-143 | None |
| A0A2E9JFS8 | 44-150 | None |
| A0A2M8PR16 | 201-313 | None |
| A0A7V5R8H8 | 6-118 | None |
| A0A2E8KH48 | 103-209 | None |
| A0A7X6TI76 | 9-143 | None |
| A0A831V5X8 | 29-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.