DPCstruct | MC40218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 159 ± 27 aa |
| Standard deviation of domain lengths | 26.96 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04751 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C1RFI6 | 2-135 | EQLDTLTISDTLRNAIEESRRIRQNEAKRRHLQYIGKIIRQEDDPEAVQRAIDAFDSGSEEHTRRHHLAERWRDRMISDGDSVTGEF… |
| A0A2D4T7G6 | 2-149 | HALQAMGERLVSLPRAELDRITIPDERLKDAVEAARNITARGGLKRQLQFIGKLMRSVDIEPIAAGLGMLDQQHAVAKADFHRIEMA… |
| A0A0W7Z1A4 | 35-211 | None |
| V4IXV2 | 3-162 | None |
| A0A2M6XWP7 | 114-230 | None |
| A0A7R9AIJ5 | 273-451 | None |
| A0A661E3N3 | 9-158 | None |
| A0A3S4HNX9 | 29-177 | None |
| A0A7R6QWF3 | 22-201 | None |
| A0A383VF57 | 2-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.