DPCstruct | MC40214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 160 |
|---|---|
| Mean domain length (aa) | 136 ± 21 aa |
| Standard deviation of domain lengths | 20.98 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 29.80 |
| Pfam Score | 81.92 |
| Assigned Pfam label(s) | CL0255- PF03946- PF00298- PF00687- CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U6UJT3 | 12-149 | RKPVLATIRLIVPAGAARPAPPVGPVLGFHRLNLMAFCKDFNARTQKYKAMQVTLTDYKDSTFEFVVKSPSVSWFLKKAAGIETASI… |
| Q4DTS8 | 40-207 | AVPEFPGKRVLHNWRFFIKAGKAATGPPVGQEFSKLGLKAMDFAKSFNDRTKPHFKDDVELIVRIQVYFDKSYLYTIEPPPTAWFIL… |
| A0A7R8XJC8 | 139-252 | None |
| A0A0G0V2B9 | 7-100 | None |
| A0A5N6P7U5 | 342-500 | None |
| A0A7J9KH35 | 37-180 | None |
| A0A7J6KWC3 | 223-380 | None |
| A0A7T5Y820 | 8-140 | None |
| A0A836AUD4 | 1-97 | None |
| A0A0B7MZ25 | 221-378 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.