DPCstruct | MC40213
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 114 ± 12 aa |
| Standard deviation of domain lengths | 12.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 52.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U6U6Z1 | 1-114 | MVADSVDMVPDSVEPDSVESLCPRCGTFHAGGVFGEACYQARRNARRCGRCGLLHEDYDMPVKWFHLMDKFDCEFYIPDVAKLEMDG… |
| A0A835A573 | 1-83 | MPDSVESPCERCGTFHAGGVFGDECFQARRHARRCARCGLLHEDYNVPARFLHGMEKFDCEFFIPHVEELQMCGNTIILPFFR |
| A2YDK4 | 35-150 | None |
| A0A4U6VG83 | 19-141 | None |
| A0A3L6QU27 | 1-100 | None |
| A0A0P0WWF2 | 82-198 | None |
| A0A4U6W9F0 | 16-120 | None |
| A0A811PFN4 | 71-207 | None |
| A0A1B6PGQ3 | 104-218 | None |
| A0A1Z5R3I7 | 132-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.