DPCstruct | MC4021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 5.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 45.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0H8N2 | 1-50 | MEPEVKRAILASWASDANAVEGNPAVRRPPRHKRPIPIDEILDALRKVDR |
| A0A2T9J822 | 7-76 | KLLRPAVGFRHPREVLKDPLLDTSEKRAILSSWASDASAVEDHPTLRWLWGTEAPAPFSEILDALARLDR |
| A0A3S3WXL2 | 5-73 | None |
| A0A175RXE3 | 4-73 | None |
| K2MZW0 | 24-93 | None |
| A0A558RAN5 | 1-66 | None |
| A0A4R3E254 | 20-88 | None |
| A0A2W6S7B0 | 7-68 | None |
| A0A7J4VJ02 | 2-58 | None |
| A0A2K9JRG8 | 20-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.