DPCstruct | MC40208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 243 ± 60 aa |
| Standard deviation of domain lengths | 60.20 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 91.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02610 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447W5X9 | 38-308 | GSETIDMDPLRPKAIWGFNGTERPGAVYLAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLS… |
| A0A379ZV38 | 4-225 | DTSIPADVEEKLLRFARAGLAVASMKGKSYLSLGGVSMGIAGSIVDHNFFESWLGMKVQVVDMTELRRRIDQKIYDEAELEMALAWA… |
| A0A1W9LHE1 | 70-309 | None |
| A0A0U3DYE4 | 55-254 | None |
| A0A3A4P947 | 1-388 | None |
| A0A7Y8J196 | 38-285 | None |
| A0A7X7JAR7 | 50-316 | None |
| A0A376RP67 | 644-933 | None |
| A0A376UFS0 | 18-252 | None |
| A0A1V6EZX1 | 61-383 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.