DPCstruct | MC40203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 12.96 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.78 |
| Pfam Score | 92.29 |
| Assigned Pfam label(s) | CL0023- PF01018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4J5E0 | 2-109 | TKHGQRLMVAKGGWHGLGNTRFKSSVNRTPRQKTMGTPGDKRDLQLELMLLADVGMLGMPNAGKSTFIRAVSAAKPKVADYPFTTLV… |
| A0A4W6EVU4 | 189-295 | EHGQEYLAVFGGAGGKGNRFFLSNENRSPMTATSGMPGEERVLQLELRTMAHAGLVGFPNAGKSSLLRAISNAKPAVAAYPFTTLNP… |
| A0A0K0EK14 | 2012-2128 | None |
| A0A7Y4ZGZ5 | 113-216 | None |
| A0A1B0C471 | 77-171 | None |
| A0A3S3Q0V8 | 238-364 | None |
| A0A061D5S3 | 1-117 | None |
| A0A5F5XVZ4 | 354-453 | None |
| A0A5J4YLG7 | 322-435 | None |
| F8CBA2 | 110-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.