DPCstruct | MC40200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 402 ± 77 aa |
| Standard deviation of domain lengths | 77.40 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 18.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0693 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q4IQB3 | 6-403 | LAFGIDLGIGSCGWAVIRQPASIEEAGTIDGIGSWIFDVPETDKERTPTNQIRRGNRLLRRVIRRRRNRMSELRSLFRQSGLLSIDS… |
| A0A2Z4IEP2 | 2-390 | NKILGIDLGTNSIGLTLREDDIFSWYGVYTFKKGVGEGKSGEFSFAAERTKHRSSRRLYNARRYRKWETLKVLIENGYCPLDIENLN… |
| A0A1H9D582 | 2-405 | None |
| A0A389M5Z5 | 6-476 | None |
| A0A2Z4I808 | 4-441 | None |
| A0A522UD60 | 13-386 | None |
| A0A3G8WGU8 | 1-378 | None |
| A0A0C2ZCQ2 | 118-453 | None |
| A0A0X8KN88 | 172-639 | None |
| R7KAN2 | 102-536 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.