DPCstruct | MC4020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 93 ± 13 aa |
| Standard deviation of domain lengths | 12.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 28.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4V8C3 | 2-86 | HYLEIPSEVLDRADARELLRFWVCDGEDYVALNSDIFGDKEPEVWGSVAADVLKHAIIAMCLNDGSRDAQKLQQRMVKALKKRLA |
| A0A2T9J188 | 1-114 | MKEQPIPDAAMRDPAATELARIWVAEHGLHCVLRIGAYDETPIDEARAWGMMLADLLRHLGRGLSDYYRRDPVEVVDVLLEAMRDEL… |
| A0A2E6QHG4 | 1-85 | None |
| A0A7L9Q9E2 | 1-111 | None |
| A0A537MUL7 | 1-78 | None |
| A0A6I6GYG5 | 19-100 | None |
| A0A258GZT5 | 1-115 | None |
| A0A2E0QRS9 | 2-91 | None |
| A0A699GG74 | 137-226 | None |
| A0A5C6CLK6 | 91-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.