DPCstruct | MC402
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 8.03 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 45.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356PU97 | 1-67 | MVEDMKLDLDSLVREDMILALPAKILCRDDCKGLCQYCGKNLNLGSCSCKKPIDPRLQALADLLIDE |
| A0A3M1RL01 | 1-76 | MDLEEEIYFIDDEFVNLVDIALEQVSLSLPIKPLCNEDCKGLCPECGQNRNERECRCKDNYIDPRFAILEKLKKNL |
| A0A533Z6E7 | 1-57 | None |
| A0A7C2EGB7 | 14-88 | None |
| A0A537IQV6 | 47-104 | None |
| A0A7T9G1L9 | 104-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.