DPCstruct | MC40191
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 159 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A229SAW6 | 1-157 | MAHDVVREAMVGYRQLVELNFPAFGDAMGLFSMLPVRVEGLVLRAENNEDPRVGLMLALHPDTGKVDDVASQVDLSVVVKDHAAEGW… |
| W7ZFH6 | 189-344 | NWVWSVYSDEQLYLRTLKIYHEVIIGYKEIVETFFPVLKNRLRKYVLYPFTLKGDFEATKETEGYSVGPSLNWHLEPLPLDHTDFIL… |
| R9IVI5 | 3-138 | None |
| A0A365URN1 | 56-211 | None |
| A0A2W4W872 | 70-238 | None |
| A0A7W7RFH3 | 758-924 | None |
| A0A5A4W2K7 | 488-661 | None |
| A0A0J1KDL7 | 296-455 | None |
| A0A7H8LHC8 | 417-576 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.