DPCstruct | MC4019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 168 ± 17 aa |
| Standard deviation of domain lengths | 17.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.60 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9NZH3 | 8-175 | ETIIFARKMIGAGFRSVVVRNSTGVSRKIIENMRKNSDAPESSCGPLSSAETLIKSNAAAVEATIFLLSYRQLAIKPDEEIDVEAVI… |
| A0A6N9SWF9 | 7-169 | LQQEIRRYRQAERLLELGARVPVVADLTHLSSWFLRKLSLEINGEAPRKGQVPNSDQWYLRRKHLLQSSLFCQIYSRVKNLLGEDDC… |
| A0A841HUY3 | 120-296 | None |
| A0A7Y8GWM1 | 40-228 | None |
| A0A1Z3MKZ6 | 1-168 | None |
| A0A257SR46 | 11-164 | None |
| A0A1A9X6T3 | 3-145 | None |
| A0A1B0C1Q4 | 3-149 | None |
| A0A522Q7J2 | 13-196 | None |
| A0A827EDU4 | 2-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.