DPCstruct | MC40186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 106 ± 7 aa |
| Standard deviation of domain lengths | 7.40 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 47.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V0NQ93 | 105-207 | LEVSQYLEDYLWPNFDPEASGPAHVMSIVVMVNQKFREGVPAWTCFHTREDVFPGFIRRVLELRSPGGPPLQQHERTAFVLFVTNVF… |
| A0A1R3G1X6 | 106-205 | LEVSQYLENYLWPNFEAETASYEHVMSMILMVNEKFRENVAAWSCFHDQKDVFRGFLERVLRLKEGRDLTIAEKTNYLVFMINAFQS… |
| A0A3P6C9V1 | 92-191 | None |
| A0A2W1BIW6 | 3-106 | None |
| A0A0N5CM55 | 44-145 | None |
| A0A0D2MVS1 | 111-225 | None |
| A0A0L0FLV2 | 373-494 | None |
| A0A6N2JXI8 | 11-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.