DPCstruct | MC40185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 230 ± 39 aa |
| Standard deviation of domain lengths | 38.85 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645E0H7 | 3-219 | ILQAARPIDEWLAEESTSAGLRQRLQTAQQMRRFASRELALPDNASYTRYAQLQRPFAVWNVVAAPAYSLEMHQWCFPVTGCIAYRG… |
| A0A7C7KAJ7 | 1-273 | MVLGSMTTETPGGASSSPENKPLGRRLLRAGLAIALLALAASCSACSPIYVIKAGIAEMQILRARQDIPEVLNDTTVDAATRGKLSF… |
| A0A7J6SCX5 | 142-361 | None |
| A0A848QA52 | 2-151 | None |
| A0A7J4QG28 | 51-258 | None |
| A0A7X7QU50 | 4-208 | None |
| A0A7J6QDA4 | 205-413 | None |
| A0A6N9CRD9 | 3-242 | None |
| A0A4D7JZ29 | 6-167 | None |
| A0A2E0Y5C3 | 1-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.