DPCstruct | MC40184
Metacluster Properties and Pfam Annotations
| Number of structural domains | 250 |
|---|---|
| Mean domain length (aa) | 188 ± 36 aa |
| Standard deviation of domain lengths | 35.61 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.91 |
| Pfam Score | 98.95 |
| Assigned Pfam label(s) | CL0063- CL0016- PF00067- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6PQF3 | 231-437 | STALPAFAAYKAVEWYAESSPKSLRPSPDQASLLYESLHEKYSPVVRNATVALRGFYLKASQMMSLRDEFLPKQYLEWCRKMQDQAP… |
| A0A842X6Y2 | 9-194 | RAHKRKIYISVLRFLLIIRKIHRYSKKGRSEKVRKLAEKNVEIFYRLGPTFIKFGQVLSSRGDMFPQEYIDKMSELQDIVPPAPFEE… |
| A0A2J8AIE6 | 138-350 | None |
| A0A849WRD7 | 240-475 | None |
| A0A1R3ICB4 | 379-612 | None |
| A7B2B3 | 30-139 | None |
| A0A5P1EVL4 | 10-107 | None |
| A0A498KUN5 | 264-495 | None |
| A0A7V9TYG3 | 12-195 | None |
| A0A4V5NB75 | 163-367 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.