DPCstruct | MC40182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 265 |
|---|---|
| Mean domain length (aa) | 236 ± 53 aa |
| Standard deviation of domain lengths | 52.96 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 75.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.22 |
| Pfam Score | 90.66 |
| Assigned Pfam label(s) | PF20845- PF16566- CL0123- CL0020- PF12350 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6PLE0 | 14-283 | KRSLTEQQVRALDHLRKKLREVAGTQEAIVGVAKIIGDMPSLSAEVCQILAEEHAHSRHINHKLSIFYVFNEIVQRSRTGNQSLLQA… |
| A0A090M5S3 | 6-151 | TKLSPEDRKSLEEILRHVTTSRDDVRDAMEFAVERAECAGDVVDVIASSLIEPDASLGTVIARLYVVSDILHNASAPVRGVQAYRTE… |
| A0A1U8F3M0 | 135-398 | None |
| A0A1A8H7Z7 | 4-217 | None |
| A0A2H3BLK8 | 164-593 | None |
| A0A1E3K5H4 | 2-237 | None |
| K3WU63 | 1-270 | None |
| M1VK36 | 13-168 | None |
| L5K596 | 5-239 | None |
| A0A1Y2HEZ7 | 5-272 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.