DPCstruct | MC40181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 120 ± 14 aa |
| Standard deviation of domain lengths | 14.34 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 64.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C5LSG4 | 16-130 | SLVSATEDPCAQMCSYVEGCAKSKFNSYCKTWQSPPVCFGLIKKSDGSICFEPTDADCVGEPIACDEQQPTGVPGTSTMESSTEVPV… |
| A0A7J6PKY8 | 15-139 | HFVSVQAESCSQLCSAIESCDASQYGSYCKGWTQGKTICQGLLMKSDGSVCYDDNSDESCFGKPVECKYDDYGFDEVVWRSMKSSAT… |
| A0A7J6R1Q3 | 51-183 | None |
| C5L2A9 | 84-202 | None |
| C5L2B0 | 10-119 | None |
| A0A7J6KTX9 | 5-130 | None |
| A0A7J6SQK9 | 74-192 | None |
| A0A7J6T8B3 | 15-150 | None |
| A0A7J6P2A6 | 16-147 | None |
| A0A7J6M4G0 | 164-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.