DPCstruct | MC40180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 149 ± 27 aa |
| Standard deviation of domain lengths | 27.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 25.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6PI06 | 24-188 | RLTSAQKALVDAISSSDDEEDHYEGAQPGRARARRSWVKTLDRVWVRVHALAWVIACVVMIYYTNFFRIVWEHPRANRGCLLIAFGL… |
| A0A5C6N3P7 | 250-365 | HSVFWIVASIGLTYYVEFFQNLKDNDDIKRWWFNIGLLLLGICLSLAMFCIVYLEWFKGIKHYDHEYPAIPPITTAAFIAASCSFNI… |
| A0A7S3GDT1 | 35-196 | None |
| A0A812VAG6 | 125-326 | None |
| F4Q4M1 | 31-209 | None |
| A0A7S3LTJ8 | 96-257 | None |
| A0A7J8U9S0 | 48-170 | None |
| C1MKV1 | 1-170 | None |
| A0A6J0YTF0 | 20-146 | None |
| A0A7J7DU41 | 28-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.