DPCstruct | MC4017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 134 ± 14 aa |
| Standard deviation of domain lengths | 13.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20118 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A9ZPW9 | 13-150 | GRVRQERRAALRDLVPAIERLRGHGEVEWSGGDQQEDGSFTFRYPIYDRDTQKVMEVCNGGALTDFDYRRTLERHGGHGLGSQAPDF… |
| A0A0S6WAT6 | 13-149 | QITPITQEGIDRLVAFLPLLSAPNARHGTYPDVVKNNNDNLLYIPSILSETASEFVQACYEEGFVQPFDWGEWSERHKDELNSAAFI… |
| D1NU32 | 308-450 | None |
| A0A542Y4N1 | 3-127 | None |
| A0A1G8PRK4 | 149-277 | None |
| A0A2S5Q6R8 | 2-153 | None |
| A0A6C2TWZ9 | 5-133 | None |
| A0A1H1RZD9 | 17-150 | None |
| A0A5C8T784 | 66-211 | None |
| A0A7W0T2L9 | 520-653 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.