DPCstruct | MC40165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 148 ± 27 aa |
| Standard deviation of domain lengths | 26.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.96 |
| Pfam Score | 72.42 |
| Assigned Pfam label(s) | CL0179- CL0198- CL0021- PF03119 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W3Z9Y8 | 25-149 | NPVAIFDAVELEGTTVTRASVHNVSIMRSLKLGVGDRIKVYKANMIIPQILENLTGSNAEQVPDSCPVCGGKTELKDEEGVQTLYCT… |
| A0A7V5C5J7 | 1-127 | RATLHNQDYINMLELAIGDTVKVSRRGKVIPAVEHVLEKNMAGNETWQMPIHCPACKTPLQREGKHHFCPNFDCPDQIRGRLIYFSK… |
| A0A837Q3Q1 | 90-310 | None |
| A0A835XV96 | 734-911 | None |
| A0A365VN64 | 1-144 | None |
| A0A837I3J9 | 1-136 | None |
| A0A7V4UW92 | 75-237 | None |
| A0A7R9R6S1 | 1-131 | None |
| A0A1Z8SCP9 | 261-408 | None |
| A0A485AZ12 | 145-308 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.