DPCstruct | MC40164
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 184 ± 40 aa |
| Standard deviation of domain lengths | 40.48 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 88.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E1ESZ8 | 3-181 | FTWIPIYSEIARKVLAFESRQEELLELLREMRSEGMKVILLNDRDAEGTRIALEEIDPFTFFASFNRTSSVSGRQAMLAKIKEAWNL… |
| W3Z2P3 | 4-157 | QFAWVDFYKEFALKLLDYKEKRDILIEKVKDIYKMTGIRMPVLDKNNHIIDIDPFTIFGLFGKNLRDENRIKIMKAIAELFGVTSKV… |
| A0A014CQV6 | 1-165 | None |
| I3XTT6 | 10-270 | None |
| A0A2K1NTX1 | 10-139 | None |
| A0A316NX05 | 3-182 | None |
| F7LZ03 | 1-175 | None |
| A0A6N9ATI2 | 9-253 | None |
| A0A2I8NR62 | 7-199 | None |
| A0A2K2UER0 | 2-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.