DPCstruct | MC40163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 130 ± 11 aa |
| Standard deviation of domain lengths | 10.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W3YBW1 | 37-160 | AEILFMEASDESLIRRYKETRRTHPLSGVGRIEAGIARERERLLFLKENADYIIDTSRLLTRELRAELYKIFINEEKYNGFVTTILS… |
| A0A5E8K8K8 | 2-121 | VTRYKETRRSHPLAATGLPLEGIALERQLLEELKGRSQLIYDTSDMKPRDLREKIVAHFATNQGETFTVNVMSFGFKYGLPIDADLV… |
| A0A2V8IDM9 | 2-117 | None |
| A0A1G7PV30 | 252-377 | None |
| A0A4U9D143 | 15-144 | None |
| A0A0H5Q211 | 316-452 | None |
| A0A164C0R8 | 62-199 | None |
| A0A6I1IQ05 | 1-128 | None |
| A0A430RSN2 | 194-311 | None |
| X8FCV1 | 730-853 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.