DPCstruct | MC40162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 113 ± 17 aa |
| Standard deviation of domain lengths | 16.82 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01774 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A373Q7B4 | 1-96 | MNGRLSLSTAFDGQKTITEDLYFAPPFKVYSPFYDHKGWAKYISMCGSAGVLAGDENEIKLFVGENCKVIFTDQGYQKLFNTNGGVS… |
| A0A1H0D6M7 | 1-110 | MKAHATLTVARRGSRSVISELRSDPPLTLRRTGSPGATAQVHVVGTAAGPLGGDSLRLDVSVLSGASLELRSTGAQIALRGTSSVHF… |
| A2X1F7 | 1-88 | None |
| K0TPQ0 | 65-170 | None |
| A0A395IFZ1 | 2-107 | None |
| T2REW7 | 1-120 | None |
| A0A146H7Z2 | 6-123 | None |
| A0A161HYL8 | 13-126 | None |
| A0A812JTZ6 | 22-135 | None |
| A0A447G1C9 | 1-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.