DPCstruct | MC40158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 301 ± 75 aa |
| Standard deviation of domain lengths | 74.78 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 75.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 91.86 |
| Assigned Pfam label(s) | CL0376- CL0137- PF10559 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2NDL8 | 59-385 | ELGAGNSLLIIMQLFFAGIIVILLDELMQKGYGMGSGISLFIATNICENIVWKAFSPSTMNTGKGTEFEGAIIALFHLLISKSDKVT… |
| A0A3D2CY98 | 2-288 | PLFTVLAHVEIAKLIFPSLARCQIASSGNAFRISVVIKSIVLLFTAIQAYGMMSALAAMDLVEGFPGATSVGIVSFVGTTAVLIWLN… |
| J9BGP3 | 90-478 | None |
| A0A226PEA4 | 879-1255 | None |
| A0A4S4EAK2 | 330-714 | None |
| A0A835S6U8 | 159-458 | None |
| A0A2J6N9A4 | 7-235 | None |
| A0A4U1F8B4 | 151-536 | None |
| A0A5J6DUH1 | 25-335 | None |
| A0A7C5X2S5 | 2-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.