DPCstruct | MC40157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 241 ± 25 aa |
| Standard deviation of domain lengths | 25.14 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A851HVB3 | 1-207 | MTSAKKRAPTVKQLRVAKGIAKHQKVPLPEWVLKDRKACKQFIDFCQRNLPPTRDQLQRLSDLGEVTGFIPPDDVVERQYLTFMWIL… |
| A0A1G1A8Q3 | 1-265 | MSDPATEKQISYIKRLGGDPKSGLSKQAASALIDSLIKSAPATVRQLKRLARLGATVPKNLTKVKADELIEQLEGDRPPEQWQIDEI… |
| M5G8N2 | 12-234 | None |
| M5G1V3 | 71-307 | None |
| A0A848AU73 | 2-276 | None |
| A0A075HI70 | 162-444 | None |
| A0A165K047 | 25-247 | None |
| A0A109E1S7 | 40-275 | None |
| I9VRQ3 | 4-206 | None |
| A0A2G8MM23 | 23-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.