DPCstruct | MC40154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 6.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2TMS2 | 121-209 | LPGKPNVGDNGVHASASPFEGMCERLNWLGADLESDYFGAALLKAGIPKQTVLDWTIDPQVPFKGSKGSIFDFLEDMDAQPCLKKAL… |
| A0A7S3W0R7 | 89-180 | LGLPREPDVGENVVHASASPFEALAERANWLGLAVKNDPFGRALLSRGISRDVIKHWAQDPMVHHDGRRQSLFDVFEGMDSAACLEV… |
| A0A0M0JZQ9 | 183-275 | None |
| A0A812TUL1 | 510-603 | None |
| A0A0M0JYK1 | 456-554 | None |
| A0A7S4ICW1 | 154-231 | None |
| K8EKV9 | 215-311 | None |
| A0A7S1FGY9 | 426-508 | None |
| A0A7S2DN60 | 479-558 | None |
| A0A7S4G7Y2 | 72-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.